DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG1986

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:370 Identity:112/370 - (30%)
Similarity:162/370 - (43%) Gaps:72/370 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFLALAFCVLAANAVEVRVNGENGWYVPQADGTMEWMDREFAEAYLE---TKNRMEGRNVLNPVT 65
            |.|....|:|          |:    ||:.:....|.....|..||:   .:|.:|..::.:.:.
  Fly     9 LLLGCLLCLL----------GD----VPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIV 59

  Fly    66 FYLYTNSNRNSPQEIKATSASISGSHFN-------------PNHPTRFTIHGWS--SSKDEFINY 115
            |...|.|.::...|:          |||             ||......:|||:  .|||     
  Fly    60 FECRTISAKDFGNEV----------HFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKD----- 109

  Fly   116 GVRDAWFT----HGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLI---NFMRSNHGLNLDN 173
            .|::...|    ..:.|:..||||.....||.|:.:::..||..||.:|   ..:|.|| .:..|
  Fly   110 WVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNH-FHRSN 173

  Fly   174 TMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYD---SPNKRLSSTDAYYVESIQTNG 235
            ..:.|:|||||.:||||. |..||:..|||||||.||||..   :|..||...||.:|:.:.|:|
  Fly   174 VTLAGYSLGAHAAGYAGA-VLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSG 237

  Fly   236 GTLGFLKPIGKGAFYPNGGKS-QPGCGV-----DLTG----SCAHSRSVIYYAESV-TENNFPTM 289
            |:||.....|...||||||:: |..|.:     |:..    ||:||.:.|::.:|: .|..|...
  Fly   238 GSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGY 302

  Fly   290 RCGDYEEAVAKECGSSYSSVRMGATTNAYMVAGDYYVPVRSDAPY 334
            .||.|.|..|..|..: ...|.|..:.. ...|.:|.......||
  Fly   303 ECGSYREFAAGYCDGN-RKARFGIHSQR-RAQGSFYFRTAPQQPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 97/301 (32%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 94/292 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.