DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and CG5966

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:307 Identity:91/307 - (29%)
Similarity:138/307 - (44%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FYLYTNSNRNSPQEIKATS-ASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTH---GD 126
            |.|:|....:.|:.:.... .|:.|...||.......:||:..|.:....:.:..|...|   |.
  Fly    80 FTLHTRRALDQPKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGEIPWMWDMAKALLAHEPEGR 144

  Fly   127 MNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGL-NLDNTMVIGHSLGAHVSGYAG 190
            .:::.:|||...|..|..:|..:..||...|.:::.:.....| ||||..:||||||||:|||||
  Fly   145 ASVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLSGYAG 209

  Fly   191 KNVKNG---QLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNG-----GTLGFLKPIGKG 247
            .::::.   :...|.|||||.|||:...|..||..|||::|:.:.|:.     |.||....:|..
  Fly   210 YHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGLGINMRLGHV 274

  Fly   248 AFYPNGGKSQPGCGVDLTG---------------SCAHSRSVIYYAESV-TENNFPTMRCGDYEE 296
            .|:||||...|||......               .|.|.||..|:.||: ::..|..:.|..:|.
  Fly   275 DFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTESIGSQCPFLGITCDSFES 339

  Fly   297 AVAKECGS----SYSSVRMGATTNAYMVAGDYYVPV------RSDAP 333
            ....:|.|    .::.:|||     |....||...|      :.|:|
  Fly   340 FKDTKCTSCEEPGHTCLRMG-----YHSQEDYQEQVDLGQLQQGDSP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 89/302 (29%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 91/307 (30%)
Pancreat_lipase_like 76..390 CDD:238363 91/307 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.