DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and Lipg

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:313 Identity:94/313 - (30%)
Similarity:147/313 - (46%) Gaps:59/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSH------FNPNHPTRFTIHGWSSSKDEFINYGVRDAWF 122
            |||.:.|:.:    .|.:..:.|:..|.      ||....|.|.||||:.|       |:.::|.
  Rat    51 VTFNIRTSKD----PEHEGCNLSLGDSKLLENCGFNMTAKTFFIIHGWTMS-------GMFESWL 104

  Fly   123 ---------THGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIG 178
                     ...:.|::.|||.......|..:|.....||.:||.::|:::.....:|.:..:||
  Rat   105 HKLVSALQTREKEANVVVVDWLPLAHQLYIDAVSNTRVVGRRVAGMLNWLQEKGEFSLGDVHLIG 169

  Fly   179 HSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTN----GGTLG 239
            :||||||:||||..|| |.:..|.|||||.|:|.....|:|||..||.:|:.:.|.    |.::|
  Rat   170 YSLGAHVAGYAGNFVK-GTVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIG 233

  Fly   240 FLKPIGKGAFYPNGGKSQPGCGV-DLTGS-----------CAHSRSVIYYAESVTENNFPT--MR 290
            ...|:|....|||||..|||||. |:.||           |.|.|:|..:.:|:...:.|:  .:
  Rat   234 IRMPVGHIDIYPNGGDFQPGCGFNDVMGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSFAFQ 298

  Fly   291 CGD---YEEAVAKECGSS------YSSVRMGATTNAYMVAGDYYVPVRSDAPY 334
            |.|   ::..:...|..:      |::.:|....|:.|     |:..|:..|:
  Rat   299 CTDPNRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKM-----YLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 92/307 (30%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 92/307 (30%)
lipo_lipase 53..488 CDD:132274 92/311 (30%)
Heparin-binding. /evidence=ECO:0000250 327..339 4/16 (25%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.