DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and Lipi

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:269 Identity:92/269 - (34%)
Similarity:137/269 - (50%) Gaps:18/269 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWS--SSKDEFINYGVRDAWFTHGD 126
            :...:|:.:|....:.:..::.|:: :.|||:..|.:.|||:.  .|...:|:...: |:....|
  Rat    59 INLLMYSRNNAKCAEPLFESNNSVN-ARFNPSKKTIWIIHGYRPLGSTPMWIHKFTK-AFLKQED 121

  Fly   127 MNMIAVDWGR-ARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAG 190
            :|:|.|||.: |.:..|..:|.....|.|.:...|..:.. ||.:|||...||.|||||:.|:.|
  Rat   122 VNLIVVDWNQGATTFIYGRAVKNTRKVAEILREYIENLLI-HGASLDNFHFIGMSLGAHICGFVG 185

  Fly   191 KNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGK 255
            | :..|||..|.|||||.|.||....|.||..|||.:|:.|.::....|.|:|.|...||||||:
  Rat   186 K-LFQGQLGRITGLDPAGPKFSGKPSNCRLDYTDAKFVDVIHSDSQGFGILEPSGHIDFYPNGGR 249

  Fly   256 SQPGCGVDLTG-----SCAHSRSVIYYAESVTEN----NFPTMRCGDYEEAVAKECGSSY--SSV 309
            :||||...|..     .|.|.|:|..:.|:...|    :||.....||:..:...||:.|  |..
  Rat   250 NQPGCPTSLLSGMDYIKCDHQRAVHLFLEAFETNCNFVSFPCRSYRDYKSGLCVGCGNLYKDSCP 314

  Fly   310 RMGATTNAY 318
            |:|...|.:
  Rat   315 RLGIQANLW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 92/269 (34%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 92/269 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.