DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and Pnlip

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:294 Identity:100/294 - (34%)
Similarity:135/294 - (45%) Gaps:50/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAW--------F 122
            |.||||.|:::.|:|.:.::||..|:|..|..||..|||       ||:.| .:.|        |
  Rat    55 FLLYTNENQDNYQKITSDASSIRNSNFKTNRKTRIIIHG-------FIDKG-EENWLSDMCKNMF 111

  Fly   123 THGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSG 187
            ....:|.|.|||.......|..:...|..||.:||.|:|.::|:.|.:.||..:||||||:||:|
  Rat   112 KVESVNCICVDWKGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGYSPDNVHLIGHSLGSHVAG 176

  Fly   188 YAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTL------GFLKPIGK 246
            .|||.. .|.:..|.|||.|.|.|.......||..|||.:|::|.|:...:      |..:.:|.
  Rat   177 EAGKRT-FGAIGRITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHTDAAPIIPNLGFGMSQTVGH 240

  Fly   247 GAFYPNGGKSQPGCG-------VDLTG---------SCAHSRSVIYYAES-VTENNFPTMRCGDY 294
            ..|:||||...|||.       ||:.|         :|.|.||..||.:| |....|....|..|
  Rat   241 LDFFPNGGMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPTGFSGFSCSSY 305

  Fly   295 EEAVAKE---CGSS-------YSSVRMGATTNAY 318
            ....|.:   |||.       |:....|.|...|
  Rat   306 NVFSANKCFPCGSEGCPQMGHYADKYPGKTKELY 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 100/294 (34%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 100/294 (34%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.