DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and Lipc

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:259 Identity:82/259 - (31%)
Similarity:119/259 - (45%) Gaps:51/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FNPNHPTRFTIHGWSSSKDEFINY---------GVRDAWF----------THGDMNMIAVDWGRA 137
            ||.:||....|||||.|:...:..         |:.:.|.          ....:|:..|||...
  Rat    78 FNSSHPLVMIIHGWSGSESATVGKDSDNDSQVDGLLETWIWKIVGALKSRQSQPVNVGLVDWISL 142

  Fly   138 RSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNV----KNGQL 198
            ....||.:|.....||::||.|:.::..:...:.....:||:||||||||:||.::    |.|: 
  Rat   143 AYQHYAIAVRNTRVVGQEVAALLLWLEESMKFSRSKVHLIGYSLGAHVSGFAGSSMGGKRKIGR- 206

  Fly   199 HTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQT-----NGGTLGFLKPIGKGAFYPNGGKSQP 258
              |.|||||.|:|...|||:|||..||.:|::|.|     .|.::|..:||....||||||..||
  Rat   207 --ITGLDPAGPMFEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGSFQP 269

  Fly   259 GC---------------GVDLTGSCAHSRSVIYYAESVTENN-----FPTMRCGDYEEAVAKEC 302
            ||               .:..|..|||.|||..:.:|:..:|     |.......:.:.:...|
  Rat   270 GCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSNLQNTGFQCSNMDSFSQGLCLNC 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 82/259 (32%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 82/259 (32%)
Pancreat_lipase_like 47..362 CDD:238363 82/259 (32%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.