DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and Liph

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001077363.1 Gene:Liph / 239759 MGIID:2388029 Length:451 Species:Mus musculus


Alignment Length:265 Identity:89/265 - (33%)
Similarity:127/265 - (47%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTH---- 124
            |...|||..::...|.|.:|:.   || .|....|.|.|||:..:       |....|...    
Mouse    41 VRLMLYTQRDQTCAQIINSTAL---GS-LNVTKKTTFIIHGFRPT-------GSPPVWIEELVQS 94

  Fly   125 ----GDMNMIAVDWGR-ARSVDY--ASSVLAVPGVGEQVATLINFMRSN---HGLNLDNTMVIGH 179
                .:||::.|||.| |.:|.|  |||..      .|||:::......   .|.:|||..:||.
Mouse    95 LISVQEMNVVVVDWNRGATTVIYPHASSKT------RQVASILKEFIDQMLVKGASLDNIYMIGV 153

  Fly   180 SLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPI 244
            |||||::|:.|::.: |:|..:.|||||.|||:...|.:||..:||.:|:.|.::...||:.:.:
Mouse   154 SLGAHIAGFVGESYE-GKLGRVTGLDPAGPLFNGRPPEERLDPSDALFVDVIHSDTDALGYKEAL 217

  Fly   245 GKGAFYPNGGKSQPGCGVDLTG-----SCAHSRSVIYYAESVTENN-----FPTMRCGDYEEAVA 299
            |...||||||..||||...:.|     .|.|..||..|..|: :||     :|.....||.....
Mouse   218 GHIDFYPNGGLDQPGCPKTIFGGIKYFKCDHQMSVYLYLASL-QNNCSITAYPCDSYRDYRNGKC 281

  Fly   300 KECGS 304
            ..||:
Mouse   282 VSCGA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 89/265 (34%)
LiphNP_001077363.1 Pancreat_lipase_like 41..310 CDD:238363 89/265 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835343
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.