DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and LIPH

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:260 Identity:86/260 - (33%)
Similarity:122/260 - (46%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAW------- 121
            |...|||..|....|.|.:::.    .:.|....|.|.:||:..:       |....|       
Human    41 VRLMLYTRKNLTCAQTINSSAF----GNLNVTKKTTFIVHGFRPT-------GSPPVWMDDLVKG 94

  Fly   122 -FTHGDMNMIAVDWGR-ARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAH 184
             .:..|||::.|||.| |.::.|..:......|...:...|:.|.: .|.:||:..:||.|||||
Human    95 LLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLA-EGASLDDIYMIGVSLGAH 158

  Fly   185 VSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAF 249
            :||:.|: :.:|.|..|.|||||.|||:......||..:||.:|:.|.::...||:.:|:|...|
Human   159 ISGFVGE-MYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFVDVIHSDTDALGYKEPLGNIDF 222

  Fly   250 YPNGGKSQPGCGVDLTG-----SCAHSRSVIYY----AESVTENNFPTMRCGDYEEAVAKECGSS 305
            |||||..||||...:.|     .|.|.|||..|    .||.|...:|.....||.......||:|
Human   223 YPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTS 287

  Fly   306  305
            Human   288  287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 86/260 (33%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 86/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145268
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.