DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:269 Identity:93/269 - (34%)
Similarity:131/269 - (48%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FYLYTNSNRNSPQEIKATS-ASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAW-------- 121
            |.||||.|.|:.|.|.||. |:|:.|:|..:..|||.|||       ||:.| .:.|        
Mouse    69 FLLYTNENPNNYQIISATDPATINASNFQLDRKTRFIIHG-------FIDKG-EEGWLLDMCKKM 125

  Fly   122 FTHGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVS 186
            |....:|.|.|||.|....:|..:......||.::|.|:..:.:..|.:.:|..:||||||:||:
Mouse   126 FQVEKVNCICVDWKRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGSHVA 190

  Fly   187 GYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTL------GFLKPIG 245
            |.||:.:: |.:..|.|||||.|.|.......||..:||.:|:.|.|:...:      |..:.:|
Mouse   191 GEAGRRLE-GHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVG 254

  Fly   246 KGAFYPNGGKSQPGCG-------VDLTG---------SCAHSRSVIYYAESV-TENNFPTMRCGD 293
            ...|:|||||..|||.       ||:.|         :|.|.||..|||.|: ..:.|....|..
Mouse   255 HLDFFPNGGKEMPGCQKNILSTIVDINGIWEGTRNFAACNHLRSYKYYASSILNPDGFLGYPCSS 319

  Fly   294 YEEAVAKEC 302
            ||:....:|
Mouse   320 YEKFQHNDC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 93/269 (35%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 93/269 (35%)
Pancreat_lipase_like 65..363 CDD:238363 93/269 (35%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 6/19 (32%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 3/21 (14%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835373
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.