DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and LIPI

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001289927.1 Gene:LIPI / 149998 HGNCID:18821 Length:460 Species:Homo sapiens


Alignment Length:267 Identity:93/267 - (34%)
Similarity:130/267 - (48%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAW--------FTH 124
            :||.:|.|..:.:...:.|:: .:||....|.:.|||:..       .|....|        ...
Human    47 MYTRNNLNCAEPLFEQNNSLN-VNFNTQKKTVWLIHGYRP-------VGSIPLWLQNFVRILLNE 103

  Fly   125 GDMNMIAVDWGR-ARSVDYASSVLAVPGVGEQVATLI-NFMRSNHGLNLDNTMVIGHSLGAHVSG 187
            .|||:|.|||.| |.:..|..:|.....|...::..| |.::  ||.:|||...||.|||||:||
Human   104 EDMNVIVVDWSRGATTFIYNRAVKNTRKVAVSLSVHIKNLLK--HGASLDNFHFIGVSLGAHISG 166

  Fly   188 YAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPN 252
            :.|| :.:|||..|.|||||.|.||...|..||..|||.:|:.|.::...||..:|:|...||||
Human   167 FVGK-IFHGQLGRITGLDPAGPRFSRKPPYSRLDYTDAKFVDVIHSDSNGLGIQEPLGHIDFYPN 230

  Fly   253 GGKSQPGC------GVDLTGSCAHSRSV-IYYAESVTENNFPTMRCGDYEE-----AVAKECGSS 305
            ||..||||      |:... .|.|.|:| ::.|...|..||.:..|..|::     .|..:|...
Human   231 GGNKQPGCPKSIFSGIQFI-KCNHQRAVHLFMASLETNCNFISFPCRSYKDYKTSLCVDCDCFKE 294

  Fly   306 YSSVRMG 312
            .|..|:|
Human   295 KSCPRLG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 93/267 (35%)
LIPINP_001289927.1 Pancreat_lipase_like 41..309 CDD:238363 93/267 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145328
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.