DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:262 Identity:87/262 - (33%)
Similarity:118/262 - (45%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FYLYTNSNRNSPQEIKA-TSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNM 129
            |.|||..|.|:.|||.| .|::|..|:|..:..||..|.||.:  |......:.:......|:|.
Human    56 FLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKT--DGKWQRDMCNVLLQLEDINC 118

  Fly   130 IAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVK 194
            |.:||... |.:|..:|..:..||.:||..|:.:......:.....:||||||||::|.||..:.
Human   119 INLDWING-SREYIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAGEAGSRIP 182

  Fly   195 NGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTL------GFLKPIGKGAFYPNG 253
            .  |..|.|||||.|.|.......||..:||.:|:.|.||...:      |.:...|...|||||
Human   183 G--LGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNG 245

  Fly   254 GKSQPGCGVDLTG-----------------SCAHSRSVIYYAESV-TENNFPTMRCGDYEEAVAK 300
            ||..|||...:|.                 .|.|:||..:||||: ..:.|....|..|....|.
Human   246 GKHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYPCRSYTSFKAG 310

  Fly   301 EC 302
            .|
Human   311 NC 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 87/262 (33%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 87/262 (33%)
Pancreat_lipase_like 52..348 CDD:238363 87/262 (33%)
PLAT_PL 355..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145253
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.