DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and LOC101884800

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:349 Identity:93/349 - (26%)
Similarity:145/349 - (41%) Gaps:75/349 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ENGWYV----------PQADGTMEWMDREFAEAYLETKNRMEGRNVLNPVTFYLYTNSNRNSPQE 79
            ||.|.:          |..:.|.|.....|.: |.:.:::...|:|..|.....|.         
Zfish     4 ENFWLLLMGFSLIASEPIFNSTEEAFASNFTD-YSDIESKFSIRSVEFPDEDLCYL--------- 58

  Fly    80 IKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWF---------THGDMNMIAVDWG 135
            :.....|||..:|..:..|...|||||.:       |:.::|.         .....|:|.|||.
Zfish    59 VPGQQDSISDCNFKNDSQTFLIIHGWSVA-------GLFESWVYKLVTALYDREPSANVIVVDWL 116

  Fly   136 RARSVDYASSVLAVPGVGEQVATLINFMRSNHGLN--LDNTMVIGHSLGAHVSGYAGKNVKNGQL 198
            ...:..|..|......||..||..:|::..   |:  |:...::|:||||||:|.|| |:.|.::
Zfish   117 DRANKHYPKSAENTRLVGADVAKFVNWLEE---LDYPLEKVHLLGYSLGAHVAGVAG-NLTNNKV 177

  Fly   199 HTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTN--GG---TLGFLKPIGKGAFYPNGGKSQP 258
            |.|.|||||.|.|......:|||..||.:|:.:.||  |.   ::|..:|:|....|||||..||
Zfish   178 HRITGLDPAGPSFENADILRRLSPDDASFVDVLHTNTRGSPDLSIGIQRPVGHVDIYPNGGTFQP 242

  Fly   259 GCGV---------------DLTGSCAHSRSVIYYAESVTENNFPT--MRCG---DYEEAVAKEC- 302
            ||.:               |....|:|.||:..:.:|:....:.:  .||.   .:.:.:...| 
Zfish   243 GCSIQHTMKLIATCGIYNMDQIVKCSHERSIHLFIDSLVNQAYQSWAFRCASRDSFNKGLCLSCR 307

  Fly   303 -------GSSYSSVRMGATTNAYM 319
                   |.:...:|...:|..|:
Zfish   308 KNRCNTLGYNVKKIRSTRSTKMYL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 82/300 (27%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 86/318 (27%)
Pancreat_lipase_like 39..335 CDD:238363 85/313 (27%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.