DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and lipg

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_002934486.2 Gene:lipg / 100498513 XenbaseID:XB-GENE-1011639 Length:500 Species:Xenopus tropicalis


Alignment Length:325 Identity:98/325 - (30%)
Similarity:155/325 - (47%) Gaps:57/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NRMEGRNV----LNP-VTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEF 112
            |.:...||    :|| |.|.::.:...:....|......:...::|.:..|...|||||.|    
 Frog    37 NLLSDENVVVPDMNPHVRFNVHFSKYDSGCFLIPGQEECLGNCNYNTSAKTFIVIHGWSMS---- 97

  Fly   113 INYGVRDAWFTH--GDM-------NMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHG 168
               |:.:.|...  |.:       |:|.|||.......|..:|.....||:.:|.|:::::....
 Frog    98 ---GLFETWLHRLVGALQERERYANVIVVDWMNLAHQLYPDAVNNTMVVGKDIAVLMDWLQEKAN 159

  Fly   169 LNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQT 233
            |:|:|..:||:||||||:|||| |...|::..|.|||||.|:|.....:||||..||.:|:.:.|
 Frog   160 LSLENVHLIGYSLGAHVAGYAG-NFVTGRIGRITGLDPAGPMFEGAEAHKRLSPDDADFVDVLHT 223

  Fly   234 N-----GGTLGFLKPIGKGAFYPNGGKSQPGCGV-DLTGS-----------CAHSRSVIYYAESV 281
            .     |.::|...|||....|||||..|||||: |:.|:           |.|.|||..:.:|:
 Frog   224 YTREALGVSIGIQMPIGHIDIYPNGGDFQPGCGLSDVLGAIAYGSIGDAVKCEHERSVHLFVDSL 288

  Fly   282 ---TENNFPTMRCGD---YEEAVAKECGSS------YSSVRMGATTNAYMVAGDYYVPVRSDAPY 334
               .:.:| ..:|.|   :::.:...|..:      |::.||.:..|:.|     ::..|:..||
 Frog   289 IHKDQESF-AFQCTDSDRFKKGICLSCRKNRCNAIGYNAKRMRSKRNSKM-----FLKTRAQMPY 347

  Fly   335  334
             Frog   348  347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 90/303 (30%)
lipgXP_002934486.2 lipo_lipase 63..488 CDD:132274 91/299 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.