DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6295 and LOC100331214

DIOPT Version :9

Sequence 1:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:305 Identity:85/305 - (27%)
Similarity:133/305 - (43%) Gaps:75/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MEGRNVLNPVTFYL----------------YTNSNRNSPQE-----IKATSASISGSHFNPNHPT 98
            :|..||||.|..:.                ::..|.:.|.:     ::..:.::|..:||....|
Zfish    25 LEEGNVLNGVFDHFLEDLRDLSDVKKLNVKFSLRNPSQPDDDVCYIVRGKAETLSSCNFNHTSKT 89

  Fly    99 RFTIHGWSSSKDEFINYGVRDAWF---------THGDMNMIAVDWGRARSVDYASSVLAVPGVGE 154
            ...||||:.|       |:.::|.         ...|.|:|.|||.......|..:......||.
Zfish    90 ILVIHGWTVS-------GLFESWVEKLVAALYNREKDANVIVVDWLDTAQDHYVVAAQNTKMVGR 147

  Fly   155 QVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKR 219
            ::...|:::.....:.|:|..:||:||||||:|:||.:..| ::..|.|||||.|.|.....:.|
Zfish   148 EIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGSHTTN-KIGRITGLDPAGPDFEGVHAHGR 211

  Fly   220 LSSTDAYYVESIQT-----NGGTLGFLKPIGKGAFYPNGGKSQPGCGVDLTGS------------ 267
            ||..||::|:.:.|     .|.::|..:|:|....|||||..||||  :|.|:            
Zfish   212 LSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHVDIYPNGGSFQPGC--NLRGALEKMASYGIFAI 274

  Fly   268 -----CAHSRSVIYYAESVTENNFPTMRCGDYEEAV--AKECGSS 305
                 |.|.||:..:.:|:..           |||.  |..|||:
Zfish   275 NNAIRCEHERSIHLFIDSLLN-----------EEAAGRAYSCGSN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 80/296 (27%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 79/283 (28%)
Pancreat_lipase_like 51..347 CDD:238363 79/279 (28%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.