DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:326 Identity:98/326 - (30%)
Similarity:145/326 - (44%) Gaps:50/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 WIGKAEAERQLEYYEAQEALEGRLSTNTVNFYLYTLQNPSTGQQIKATQD-SIDGSFFNPQNPTR 106
            |.|.|....:|..:..::       .|| .|.|||.:||:..|.::.:.. :|..|.|.....||
  Rat    34 WAGTAIRPLKLLPWSPEK-------INT-RFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTR 90

  Fly   107 ITIHGWNSNYKDGVNTRVADAWFQYGDYNMIAVDWLRGRSLEYASSVAGAPGAGKKVAALVDFLV 171
            ..|||:....::.....:....||..:.|.|.|||.:|....|..:.......|.:||.::|.||
  Rat    91 FIIHGFIDKGEENWVVDMCKNMFQVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILV 155

  Fly   172 EGYGMSLDTLEIVGFSLGAHVAGHTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVE 236
            :.|..|...:.::|.||||||||....:...  :|::.||||.......:..|.||...||.:|:
  Rat   156 KNYSYSPSKVHLIGHSLGAHVAGEAGSRTPG--LGRITGLDPVEANFEGTPEEVRLDPSDADFVD 218

  Fly   237 SIQTNGA----ILGFG--QPIGKASFYMNGGRSQPGCG-------IDITG---------SCSHTK 279
            .|.|:.|    .||||  |..|...|:.|||:|.|||.       :||.|         :|:|.:
  Rat   219 VIHTDAAPLIPFLGFGTNQMSGHLDFFPNGGQSMPGCKKNALSQIVDIDGIWSGTRDFVACNHLR 283

  Fly   280 AVLYYVEALL-WNNFPSIKCESSVDANKNNC-----------GNTYSSVFMGAS----INFFVAE 328
            :..||:|::| .:.|.:..|.|..|...|.|           |: |:..|.|.|    ..||:..
  Rat   284 SYKYYLESILNPDGFAAYPCASYKDFESNKCFPCPDQGCPQMGH-YADKFAGKSGDEPQKFFLNT 347

  Fly   329 G 329
            |
  Rat   348 G 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 92/298 (31%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 98/326 (30%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338968
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.