DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and CG4582

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:347 Identity:104/347 - (29%)
Similarity:161/347 - (46%) Gaps:39/347 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VPQREGGLRWIGKAEAERQLEYYEAQEALEGRLSTNTVNFYLYTLQNPSTGQQIKATQD------ 92
            ||| :...|..|..::|::..:....:.:.|  :|.|..|.|..:......|..:.|.:      
  Fly    89 VPQ-DNANRQTGPLKSEKESPHRRLFQQVVG--NTLTAAFGLNVMNKGDQEQNQQFTSEPVNLYD 150

  Fly    93 --SIDGSFFNPQNPTRITIHGWNSNYKDGVNTRVADAWF--QYGDYNMIAVDWLRGRSLEYASSV 153
              |:..|.|:|.|||||.||||..|....:...:..|:|  :.|:||:..|||.||...:|.::.
  Fly   151 AASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITAS 215

  Fly   154 AGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFSLGAHVAGHTAKQVNSGKVGKVVGLDPASPLI 218
            ......|:.:|..||||.:..||..:.|::||||:||||||...|.:.:|::..:..||||.|..
  Fly   216 YRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFF 280

  Fly   219 SYSNTEKRLSSDDALYVESIQTNGAILGFGQPIGKASFYMNGGRSQPGCGIDITGSCSHTKAVLY 283
            .|:..::||:::||.|||.:.|:....||.:|:|...||.|.|..||||   ....|||.:|.:.
  Fly   281 RYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGC---FWHECSHWRAFML 342

  Fly   284 YVEALL----------------WNNFPSI-KCESSVDANKNNCGNTYSSVFMGASINFFV-AEGI 330
            :.|:|.                |...... :|.......:...|:     ....|..|.. .:|:
  Fly   343 FAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMGGD-----LANVSAEFLAQRQGV 402

  Fly   331 FYVPVNKESPYGLGELNSGGEA 352
            :|...|.:.||.|.:..|...|
  Fly   403 YYFQTNDQPPYVLAQNASSKRA 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 89/293 (30%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 86/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405444at33208
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.