DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and CG5665

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster


Alignment Length:277 Identity:85/277 - (30%)
Similarity:119/277 - (42%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SFFNPQNPTRITIHGW-NSNYKDGVNTRVADAWFQYGDYNMIAVDWLRGRSLEYASSVAGAPGAG 160
            |.|:......|...|| |:..:....:.::.|:...||.|.:.||........||.|.......|
  Fly   111 SRFSKGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIG 175

  Fly   161 KKVAALVDFLVE-----------GY------GMSLDTLEIVGFSLGAHV---AGHTAKQVNSGKV 205
            :.:...:..|:|           |:      .::..:...||.|||||:   ||.|.|::....:
  Fly   176 EHIGVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLI 240

  Fly   206 GKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTNGAILGFGQPIGKASFYMNGGRS-QPGCGI 269
            .::.|||||.|..........|:..||..|:.|.||..||....|:|...||..|... ||||  
  Fly   241 PRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGC-- 303

  Fly   270 DITGSCSHTKAVLYYVEALL---WNNFPSIKCESSVDANKNNCGNTYSSVFMGASINFFVAEGIF 331
             :|..||||:||.|:.|:..   ..||...||.|..:..|.:|.....|. ||..:| ..|.||:
  Fly   304 -LTIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSP-MGYRMN-PQARGIY 365

  Fly   332 YVPVNKESPYGLGELNS 348
            ||.||...|||....|:
  Fly   366 YVDVNGWPPYGRNSENT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 80/264 (30%)
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446083
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.