DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and LIPC

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:289 Identity:90/289 - (31%)
Similarity:127/289 - (43%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FYLYTLQNPSTGQQIKATQ-DSIDGSFFNPQNPTRITIHGWNSNYKDGVNTRVADAWFQYGDYNM 136
            |.|:...|  .|.||:... |::....||...|..:.||||:   .||    |.:.|.    :.|
Human    64 FLLFGETN--QGCQIRINHPDTLQECGFNSSLPLVMIIHGWS---VDG----VLENWI----WQM 115

  Fly   137 IA--------------VDWLRGRSLEYASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFS 187
            :|              |||:......|..:|......||:||||:.:|.|...:|...:.::|:|
Human   116 VAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYS 180

  Fly   188 LGAHVAGHTAKQV-NSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQT-----NGAILG 246
            |||||:|.....: .:.|:|::.|||.|.||...|....|||.|||.:|::|.|     .|..:|
Human   181 LGAHVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVG 245

  Fly   247 FGQPIGKASFYMNGGRSQPGC---------------GIDITGSCSHTKAVLYYVEALL------- 289
            ..||||...||.|||..||||               .|..|..|||.::|..::::||       
Human   246 IKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSM 310

  Fly   290 ------WNNFPSIKCESSVDANKNNCGNT 312
                  .|:|....|   :...|..| ||
Human   311 AYPCGDMNSFSQGLC---LSCKKGRC-NT 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 90/289 (31%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.