DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and CG10116

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:280 Identity:87/280 - (31%)
Similarity:135/280 - (48%) Gaps:29/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FYLYTLQNPSTGQQIKATQDSIDGSFFNPQNPTRITIHGWNSNYKDGVNTRVADAWFQYGDYNMI 137
            |:|.|.:.....|.|:|..:::..|.|...:||.:||..|..|........|..|..|..|.|:|
  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88

  Fly   138 AVDWLRGR-SLEYASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFSLGAHVAGHTAKQVN 201
            :||..... ..|...|          ||:||..|...:.|.||.:.:|||:.|||:||..|.:|.
  Fly    89 SVDLSEANDETEIIDS----------VASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQ 143

  Fly   202 SG---KVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTNGAILGFGQPIGKASFYMNGGRS 263
            ..   ::.::..|||:|.    :..:.:||..||.:||.:.||....|..:.:|...:|.|||::
  Fly   144 QDLGRQLSQITALDPSSG----AELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQT 204

  Fly   264 QPGCGIDITGSCSHTKAVLYYVEALLW---NNFPSIKCESSVDANKNNCGNTYSSVFMG-ASINF 324
            ||||   .|.||||.:|  :.:.|.:|   |:|.|.:|.|....:.::|  .:|:..|| .....
  Fly   205 QPGC---TTDSCSHERA--FELLAEMWSPENDFVSARCGSVETLSASSC--RWSTHKMGQKQEEE 262

  Fly   325 FVAEGIFYVPVNKESPYGLG 344
            ..|.||:::...:.||:..|
  Fly   263 QPASGIYFLETRQSSPFSRG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 84/271 (31%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 84/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.