DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and lipg

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:281 Identity:84/281 - (29%)
Similarity:139/281 - (49%) Gaps:35/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QDSIDGSFFNPQNPTRITIHGWNSN--YKDGVNTRVADAWFQYGDYNMIAVDWLRGRSLEYASSV 153
            ::||....||....|.:.||||..:  ::..::..||....:..:.|::.||||...:..|..:|
Zfish    75 KESIVACGFNATLRTILIIHGWTMSGMFESWMHKLVAAVQRRESEANVVVVDWLGLANQLYPDAV 139

  Fly   154 AGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFSLGAHVAGHTAKQVNSGKVGKVVGLDPASPLI 218
            ......|:.:|.|:|:|.|...:.|:.:.|:|:||||||||:....|| |.:|::.|||||.|:.
Zfish   140 NHTRRVGQSIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFVN-GIIGRITGLDPAGPMF 203

  Fly   219 SYSNTEKRLSSDDALYVESIQ--TNGAI---LGFGQPIGKASFYMNGGRSQPGCGID-----ITG 273
            ..:::..:||.|||.:|:.:.  |.||:   :|..:|||....|.|||..||||...     .:|
Zfish   204 EGADSYNKLSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFLSAASG 268

  Fly   274 S------CSHTKAVLYYVEALLWNNFPS--IKCES--------SVDANKNNCGNT-YSSVFMGAS 321
            :      |.|.:||..:|::|:..:..|  .:|..        .:...||.|.:. |::..|...
Zfish   269 NFMEAMKCEHERAVHLFVDSLMNKDHVSYAFQCTGPDRFKKGICLSCRKNRCNSIGYNAKKMRKR 333

  Fly   322 INFFVAEGIFYVPVNKESPYG 342
            .|     ...|:....::|:|
Zfish   334 RN-----SKMYLKTRADTPFG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 82/274 (30%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 84/281 (30%)
Pancreat_lipase_like 65..344 CDD:238363 82/274 (30%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.