DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and CG13562

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:342 Identity:69/342 - (20%)
Similarity:119/342 - (34%) Gaps:88/342 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AERQLEYYEAQEALEGRLSTNTVNFYLYTLQNPSTGQQIKATQDSID--GSFFNPQNPTRITIHG 111
            |.:|...|:||:.::       |.||    :|.:...:..|..|:.|  ||..:|.:...|.:||
  Fly    48 AHQQRIKYDAQKTMK-------VMFY----KNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHG 101

  Fly   112 WNSNYKDGVNTRVADAWFQYGDYNMIAVDWLRGRSLEYA------SSVAGAPGAGKKVAALVDFL 170
            |..:..|.....:.:....|....:|.:|:....|..|.      .::.||      :::::..|
  Fly   102 WIQSCSDEWALSLIERLSYYRGGCVICIDYSVVASSSYMRLYTNFDTLTGA------ISSIILTL 160

  Fly   171 V-------EGYGMSLDTLEIVGFSLGAHVAGHTAKQVNSGKVGKVV--------GLDPASPLISY 220
            .       .||        :.|||.|..:|....:.:....:.:.:        |.||.:  :.:
  Fly   161 FRQGFDPKRGY--------MFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGFDPIA--VDH 215

  Fly   221 SNTEKRL-----SSDDALYVESIQTNGAI--LGFGQPIGKASFYMNGGRSQPGCGIDITGSCSHT 278
            |...|.:     |.|...:|.|...|..:  .|..||...:..::.                ||.
  Fly   216 SKAGKHVQCFHSSRDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLG----------------SHG 264

  Fly   279 KAVLYYVEALLWN----NFPSIKCESSVDANKNNCGNTYSSVFMGASINF-FVAEGIFYVPVNKE 338
            ..|..|:....:.    |:...:|.:.....|...|.|     :|...|| ....|..:||.:..
  Fly   265 LCVDIYINTFDYPFYAVNYTPPECFTWQKTAKIPDGYT-----VGYEENFDSQVTGQIFVPTSLH 324

  Fly   339 SPYGLGE-----LNSGG 350
            .||.|.:     |..||
  Fly   325 YPYNLSKKQLKLLTKGG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 58/300 (19%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 29/161 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.