DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and CG6472

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:369 Identity:112/369 - (30%)
Similarity:180/369 - (48%) Gaps:35/369 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YYEAQEALEGRLST-------NTVNFYLYTLQNPSTGQQIKATQDS-IDGSFFNPQNPTRITIHG 111
            :|.|  |..|..||       ..:.|.|||.:|.::.|.:..:.|: :..|.||...|..|.:||
  Fly    23 FYSA--APRGSCSTCCAIKEREDIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHG 85

  Fly   112 WNSNY--KDGVNTRVADAWFQYGDYNMIAVDWLRGRSLE-YASSVAGAPGAGKKVAALVDFLVE- 172
            ::.:.  :...:..:.||:.:.|:||:|.:||....::. |:::|...|.:|:.:|..:.|||: 
  Fly    86 FSESATGERQSSQELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDK 150

  Fly   173 GYGMSLDTLEIVGFSLGAHVAGHTAKQVNSG--KVGKVVGLDPASPLISYSNTEKRLSSDDALYV 235
            ||....  :.::||||||.|||...||:...  |:.::..||||.||...:::.:|||..||.:|
  Fly   151 GYPAKY--IHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFV 213

  Fly   236 ESIQTNGAILGFGQPIGKASFYMNGGRS-QPGCG--------IDITGSCSHTKAVLYYVEALLW- 290
            :.|.|:|.:||...|:|.|.||.||||. ||||.        :.|...|||.:|..|:||::.. 
  Fly   214 DVIHTDGGLLGNPAPMGHADFYPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQP 278

  Fly   291 NNFPSIKCE-SSVDANKNNCGNTYSSVFMGASINFFVAEGIFYVPVNKESPYGLGELNSGGEATT 354
            ..||:.:|| |.:.......|...:.:.|||....   .|.||:..|...|:|   .||...|..
  Fly   279 RGFPAQRCEPSDMFGICREPGGGPAFMGMGADPRI---RGKFYLDTNDAKPFG---RNSRARAIV 337

  Fly   355 GTPEITSTTVDGEDESTTEVSTSTTTDKPEESTTEEPEEDSTTN 398
            ...............:|.:.|.|...:..:|...|:.:.::.:|
  Fly   338 SLAPRLPIAYKLPPNATRQPSVSRWANGQKEQDNEDEDNNALSN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 94/283 (33%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 94/284 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.