DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and CG17292

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:348 Identity:81/348 - (23%)
Similarity:139/348 - (39%) Gaps:62/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TVNFYLYTLQNPSTGQ----QIKATQDSIDGSFFNPQNPTRITIHGWNSNYKDGVNTR----VAD 126
            |..|.||  ..|:...    .:...|..::....:....|.:.:||    |.:..:..    :|:
  Fly    24 TAKFILY--YGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHG----YLEDPDVESIHVIAE 82

  Fly   127 AWFQYGDYNMIAVDWLRGRSLE-------YASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIV 184
            |:.:..|.|:|.:||  |...:       :.:.....|...|.:..:.|     :|:.::...||
  Fly    83 AYLERKDTNLIVLDW--GELADGNYMFDAFPNLKQLGPELAKVLLKMFD-----HGLDIEKFHIV 140

  Fly   185 GFSLGAHVAGHTAKQVNS-----GKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTNGAI 244
            |.|:|..:||...:::..     .|:.::..||||.||. |..|  .||::||.:|:.|.|:..:
  Fly   141 GHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF-YPGT--HLSANDAEFVDVIHTDAWL 202

  Fly   245 LGFGQPIGKASFYMNGGRS-QPGCG------IDITGSCSHTKAVLYYVEALLWN---NFPSIKCE 299
            .|.....|.|.|:.|||.| ||||.      :......||.::..::.|::...   .|.::..:
  Fly   203 YGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAK 267

  Fly   300 SSVDANKNNCGNTYSSVFMGASINFFVAEGIFYVPVNKESPYGLGELNSGGEATTGTPEITSTTV 364
            ...|..:|........|.||......: .|.||:..|..:|:..|:        .||..:....:
  Fly   268 KWSDFKQNKIVENCPPVVMGHHCPTTI-HGDFYLQTNGHTPFARGK--------EGTVYVDPKDL 323

  Fly   365 DGEDESTTEVSTSTTTDKPEEST 387
            .|.       :.|.|.|.|.|.|
  Fly   324 LGN-------THSITCDCPSEKT 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 68/295 (23%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 69/295 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.