DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and CG4267

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:303 Identity:88/303 - (29%)
Similarity:137/303 - (45%) Gaps:41/303 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 STNTVNFYLYTLQNPSTGQQI-KATQDSIDGSFFNPQNPTRITIHGWNSNYKDGVNTRVADAWFQ 130
            |...:.|.|:.......|::: ....:::..|.|:.::.|||.||||.|..|.....:|.:|:..
  Fly    68 SRGKMQFILFKRDFADCGRELFVGDVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLS 132

  Fly   131 ------------YGDYNMIAVDWLR-GRSLEYASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLE 182
                        |.|:|:|..||.: ..::.|..........|..:|.||.:|.:...|..|.:.
  Fly   133 LTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVY 197

  Fly   183 IVGFSLGAHVAGHTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTNGAILGF 247
            ::|.||||.:||...||:...:...:..||||.|.....:.|.|:.:.||.|||||||: ...||
  Fly   198 VIGHSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYVESIQTS-VSFGF 261

  Fly   248 GQPIGKASFYMNGGRSQPGCGIDITGSCSHTKAVLYYVEAL-----LWNNFPSIKCESSVDANKN 307
            .||:|.|:||.|.|::|..|.:   ..|||.::..|::|:|     .|..    :||...|    
  Fly   262 EQPVGHATFYPNYGKNQKKCYV---YGCSHKRSHDYFIESLTSPAGFWGP----RCERHDD---- 315

  Fly   308 NCGNTYSSVF------MGASINFFVAEGIFYVPVNKESPYGLG 344
               .|:..:.      ||...: ....|.|||....:.||.:|
  Fly   316 ---GTWLLLMSDGEFRMGGEPS-IPKNGTFYVKTYSKPPYAMG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 84/290 (29%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 85/298 (29%)
Pancreat_lipase_like 71..347 CDD:238363 84/291 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438411
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.