DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and lpl

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:268 Identity:82/268 - (30%)
Similarity:122/268 - (45%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FYLYTLQNPS-------TGQQIKATQDSIDGSFFNPQNPTRITIHGW--NSNYKDGVNTRVADAW 128
            |...||:.|.       .||     ..||....||.:..|.|.||||  ...::..|...|...:
Zfish    60 FSFRTLEEPEDDLCYIVPGQ-----PQSIKDCNFNTETKTFIVIHGWTVTGMFESWVPKLVTALY 119

  Fly   129 FQYGDYNMIAVDWLRGRSLEYASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFSLGAHVA 193
            .:....|:|.||||......|.:|.:.....||.||..|::|........:.|.::|:|||||||
Zfish   120 EREPSANVIVVDWLSRAQQHYPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVA 184

  Fly   194 GHTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTN-----GAILGFGQPIGK 253
            | .|..:...||.::.|:|||.|...|:::...||.|||.:|:.:.||     ...:|..:|:|.
Zfish   185 G-IAGLLTKHKVNRITGMDPAGPTFEYADSLSTLSPDDANFVDVLHTNTRGSPDRSIGIQRPVGH 248

  Fly   254 ASFYMNGGRSQPGCGID-------ITG--------SCSHTKAVLYYVEALLWNNFPSI--KCESS 301
            ...|.|||..||||.:.       .||        .|||.:::..::::|:..:..|:  :|.|.
Zfish   249 IDIYPNGGTFQPGCDLQNTMLMVATTGLRNMDQIVKCSHERSIHLFIDSLVNQDHESMAFRCSSR 313

  Fly   302 VDANKNNC 309
            ...||..|
Zfish   314 DSFNKGMC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 82/268 (31%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 82/268 (31%)
Pancreat_lipase_like 56..353 CDD:238363 82/268 (31%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.