DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and Pnlip

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:351 Identity:102/351 - (29%)
Similarity:151/351 - (43%) Gaps:51/351 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 WIGKAEAE-RQLEYYEAQEALEGRLSTNTVNFYLYTLQNPSTGQQIKATQDSIDGSFFNPQNPTR 106
            |.|..:.. :.|.:..||        .|| .|.|||.:|....|:|.:...||..|.|.....||
  Rat    33 WSGTIDRPLKALPWSPAQ--------INT-RFLLYTNENQDNYQKITSDASSIRNSNFKTNRKTR 88

  Fly   107 ITIHGWNSNYKDGVNTRVADAWFQYGDYNMIAVDWLRGRSLEYASSVAGAPGAGKKVAALVDFLV 171
            |.|||:....::...:.:....|:....|.|.|||..|....|..:.......|.:||.||:.|.
  Rat    89 IIIHGFIDKGEENWLSDMCKNMFKVESVNCICVDWKGGSRATYTQATQNVRVVGAEVALLVNVLK 153

  Fly   172 EGYGMSLDTLEIVGFSLGAHVAGHTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVE 236
            ...|.|.|.:.::|.|||:||||...|: ..|.:|::.|||.|.|....:..|.||...||.:|:
  Rat   154 SDLGYSPDNVHLIGHSLGSHVAGEAGKR-TFGAIGRITGLDAAEPYFQGTPEEVRLDPTDAQFVD 217

  Fly   237 SIQTNGA----ILGFG--QPIGKASFYMNGGRSQPGCG-------IDITG---------SCSHTK 279
            :|.|:.|    .||||  |.:|...|:.|||...|||.       :||.|         :|:|.:
  Rat   218 AIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLR 282

  Fly   280 AVLYYVEALL-WNNFPSIKCES--SVDANK-NNCGNT-------YSSVFMGASINFFVAEGIFYV 333
            :..||.:::: ...|....|.|  ...||| ..||:.       |:..:.|.:...:..   ||:
  Rat   283 SYKYYTDSIVNPTGFSGFSCSSYNVFSANKCFPCGSEGCPQMGHYADKYPGKTKELYQK---FYL 344

  Fly   334 PVNKESPYGLGE----LNSGGEATTG 355
            ....:|.:....    :...|:..||
  Rat   345 NTGDKSNFARWRYQVTVTLSGQKVTG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 91/298 (31%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 99/331 (30%)
PLAT_PL 355..465 CDD:238857 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.