DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and Lipg

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus


Alignment Length:273 Identity:85/273 - (31%)
Similarity:129/273 - (47%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PSTGQQIKATQDS--------------IDGSFFNPQNPTRITIHGWNSN--YKDGVNTRVADAWF 129
            ||....|:.::|.              ::...||....|...||||..:  ::..::..|:....
Mouse    47 PSVAFNIRTSKDPEQEGCNLSLGDSKLLENCGFNMTAKTFFIIHGWTMSGMFESWLHKLVSALQM 111

  Fly   130 QYGDYNMIAVDWLRGRSLEYASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFSLGAHVAG 194
            :..|.|::.||||......|..:|......|::||.::|:|.|....||..:.::|:||||||||
Mouse   112 REKDANVVVVDWLPLAHQLYTDAVNNTRVVGQRVAGMLDWLQEKEEFSLGNVHLIGYSLGAHVAG 176

  Fly   195 HTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTN----GAILGFGQPIGKAS 255
            :....| .|.||::.|||||.|:....:..:|||.|||.:|:.:.|.    |..:|...|:|...
Mouse   177 YAGNFV-KGTVGRITGLDPAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIGIRMPVGHID 240

  Fly   256 FYMNGGRSQPGCGI-DITGS-----------CSHTKAVLYYVEALLWNNFPS--IKCESS----- 301
            .|.|||..|||||. |:.||           |.|.:||..:|::|:..:.||  .:|..|     
Mouse   241 IYPNGGDFQPGCGFNDVIGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSSRFKR 305

  Fly   302 ---VDANKNNCGN 311
               :...||.|.|
Mouse   306 GICLSCRKNRCNN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 85/273 (31%)
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 83/271 (31%)
lipo_lipase 51..485 CDD:132274 83/269 (31%)
Heparin-binding. /evidence=ECO:0000250 325..337
PLAT_LPL 347..483 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.