DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and Lipc

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:326 Identity:89/326 - (27%)
Similarity:142/326 - (43%) Gaps:73/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RWIGKAEAERQLEYYEAQEALEGRLSTNTVNFYLYTLQNPSTGQQIKATQ-DSIDGSFFNPQNPT 105
            |.:|..||.:.|:..|.:             |.|:..:|...|.:::... :::....||...|.
Mouse    33 RSLGATEASKPLKKPETR-------------FLLFQDENDRLGCRLRPQHPETLQECGFNSSQPL 84

  Fly   106 RITIHGW------------NSNYK-DGVNTRVADAWF----------QYGDYNMIAVDWLRGRSL 147
            .:.||||            :|:|: ||    :.:.|.          |....|:..|||:.....
Mouse    85 IMIIHGWSGSESATVGKDSDSDYQVDG----LLENWIWKIVSALKSRQSQPVNVGLVDWISLAYQ 145

  Fly   148 EYASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFSLGAHVAGHTAKQVN-SGKVGKVVGL 211
            .|..:|......|:.||||:.:|.|....|...:.::|:||||||:|.....:: ..|:|::.||
Mouse   146 HYTIAVQNTRIVGQDVAALLLWLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGL 210

  Fly   212 DPASPLISYSNTEKRLSSDDALYVESIQT-----NGAILGFGQPIGKASFYMNGGRSQPGC---- 267
            |||.|:...::..:|||.|||.:|::|.|     .|..:|..|||....||.|||..||||    
Mouse   211 DPAGPMFEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLE 275

  Fly   268 -----------GIDITGSCSHTKAVLYYVEALLWNNFPSIKCESS----------VDANKNNCGN 311
                       .|..|..|:|.::|..::::|..::..||..:.|          :...|..| |
Mouse   276 LYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSDLQSIGFQCSDMGSFSQGLCLSCKKGRC-N 339

  Fly   312 T 312
            |
Mouse   340 T 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 83/297 (28%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 89/326 (27%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835356
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.