DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and LOC101884800

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:278 Identity:83/278 - (29%)
Similarity:126/278 - (45%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LEGRLSTNTVNF------YLYTLQNPSTGQQIKATQDSIDGSFFNPQNPTRITIHGWN--SNYKD 118
            :|.:.|..:|.|      ||           :...||||....|...:.|.:.||||:  ..::.
Zfish    39 IESKFSIRSVEFPDEDLCYL-----------VPGQQDSISDCNFKNDSQTFLIIHGWSVAGLFES 92

  Fly   119 GVNTRVADAWFQYGDYNMIAVDWLRGRSLEYASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEI 183
            .|...|...:.:....|:|.||||...:..|..|.......|..||..|::| |.....|:.:.:
Zfish    93 WVYKLVTALYDREPSANVIVVDWLDRANKHYPKSAENTRLVGADVAKFVNWL-EELDYPLEKVHL 156

  Fly   184 VGFSLGAHVAGHTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTN-----GA 243
            :|:|||||||| .|..:.:.||.::.|||||.|....::..:|||.|||.:|:.:.||     ..
Zfish   157 LGYSLGAHVAG-VAGNLTNNKVHRITGLDPAGPSFENADILRRLSPDDASFVDVLHTNTRGSPDL 220

  Fly   244 ILGFGQPIGKASFYMNGGRSQPGCGI---------------DITGSCSHTKAVLYYVEALLWNNF 293
            .:|..:|:|....|.|||..||||.|               |....|||.:::..::::|:...:
Zfish   221 SIGIQRPVGHVDIYPNGGTFQPGCSIQHTMKLIATCGIYNMDQIVKCSHERSIHLFIDSLVNQAY 285

  Fly   294 PS--IKCESSVDANKNNC 309
            .|  .:|.|....||..|
Zfish   286 QSWAFRCASRDSFNKGLC 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 81/269 (30%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 83/278 (30%)
Pancreat_lipase_like 39..335 CDD:238363 83/278 (30%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.