DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and LOC100331214

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:296 Identity:82/296 - (27%)
Similarity:134/296 - (45%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YTLQNPSTGQQ-----IKATQDSIDGSFFNPQNPTRITIHGWNSN--YKDGVNTRVADAWFQYGD 133
            ::|:|||....     ::...:::....||..:.|.:.||||..:  ::..|...||..:.:..|
Zfish    55 FSLRNPSQPDDDVCYIVRGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAALYNREKD 119

  Fly   134 YNMIAVDWLRGRSLEYASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFSLGAHVAG---- 194
            .|:|.||||......|..:.......|:::...:|::.|...:.|:.|.::|:||||||||    
Zfish   120 ANVIVVDWLDTAQDHYVVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGS 184

  Fly   195 HTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQT-----NGAILGFGQPIGKA 254
            ||     :.|:|::.|||||.|.....:...|||.|||.:|:.:.|     .|..:|..||:|..
Zfish   185 HT-----TNKIGRITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHV 244

  Fly   255 SFYMNGGRSQPGCGIDITGS-----------------CSHTKAVLYYVEALLWNNFP--SIKCES 300
            ..|.|||..||||  ::.|:                 |.|.:::..::::||.....  :..|.|
Zfish   245 DIYPNGGSFQPGC--NLRGALEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAYSCGS 307

  Fly   301 S--------VDANKNNC---GNTYSSVFMGASINFF 325
            :        :...||.|   |...|.|....|:..|
Zfish   308 NDMFDRGVCLQCRKNGCNTVGYDISKVRKARSVKMF 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 82/296 (28%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 82/296 (28%)
Pancreat_lipase_like 51..347 CDD:238363 82/296 (28%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.