DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6296 and lipib

DIOPT Version :9

Sequence 1:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:268 Identity:86/268 - (32%)
Similarity:122/268 - (45%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EGRLSTNT-VNFYLYTLQNPSTGQQI---KATQDSIDGSFFNPQNPTRITIHGWNSNYKDGVNTR 123
            |..:.||. |...|||..|...||::   ..||..:    ||...||...|||:..       |.
Zfish    33 ESFIGTNLYVRLLLYTRANLECGQELPHHNFTQQPL----FNVTRPTTFVIHGYRP-------TG 86

  Fly   124 VADAWFQY--------GDYNMIAVDWLRG-RSLEYASSVAGAPGAGKKVAALVDFLVEGYGMSLD 179
            ....|..:        .|.|::.|||.|| .:|.|.::||...|....:...::.: |..|.|||
Zfish    87 APPIWINHIVHLLAAQKDMNILVVDWNRGAANLNYLTAVANTRGTALNITRFIESM-EKEGASLD 150

  Fly   180 TLEIVGFSLGAHVAGHTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTNGAI 244
            ::.::|.||||||||.....: .|:||::.|||||.|:.:..:.|:||...||.:|:.:.|:...
Zfish   151 SIHLIGVSLGAHVAGFIGAML-GGRVGRITGLDPAGPMFASVSPEERLDPTDAQFVDVLHTDMNS 214

  Fly   245 LGFGQPIGKASFYMNGGRSQPGCGIDITGS-----CSHTKAVLYYVEALLWNNFPSI---KCESS 301
            .|.....|...||.|||..||||...|...     |.|.::|..|:.:|  |...|:   .|.|.
Zfish   215 FGLRGTHGHIDFYANGGLDQPGCPKTIFSGKSYFVCDHQRSVFLYLCSL--NRTCSLTGYPCSSY 277

  Fly   302 VDANKNNC 309
            .|.....|
Zfish   278 SDFLSGQC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 83/259 (32%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 85/264 (32%)
Pancreat_lipase_like 40..324 CDD:238363 83/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.