DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlC and TwdlD

DIOPT Version :9

Sequence 1:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:281 Identity:62/281 - (22%)
Similarity:110/281 - (39%) Gaps:78/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YQPLPQEQSFANFAP---------PQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRL 109
            |||:.......:|.|         |.|. ||.|         :..|..::|:.|     .:|.::
  Fly    23 YQPVAHADEGLSFLPGSGQVIGELPSQV-LPVQ---------SGEAVLSQPIEA-----PVAPQI 72

  Fly   110 SGVQHASGYNNGPQETKVHKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAI 174
            :           |...:..|..|.:..|::..:|.|...::.:.   .:|:.::|||:.|.....
  Fly    73 A-----------PLVEEFQKEFYSYAAPEEQYDEGASNQQIANS---LKKNLRVVFIRTPENQGF 123

  Fly   175 RQPVVPPPPQN-EEKTLIYVLHKKPE----QEQDIVIPTPPPTKPSKPEVYFIKYKTKKDEAPVY 234
            .:..:....|: :::|.||||.|:.:    .:|...:.|   :..:||||:|:||:|.:|.|   
  Fly   124 ERAALQLAKQSAQQETAIYVLTKQSDVSNLAKQLNALKT---SSTNKPEVHFVKYRTPEDAA--- 182

  Fly   235 GPPPAEMEPRQATAEDFAPLAEVADV-----LPPTTLAPAPEPEVEQPAI----PSAVYGPPTAA 290
                   ..:.|....:..|..|:.:     .|....|.:|......||:    ||:.|.|....
  Fly   183 -------NAQLAIQNQYNQLPGVSRISNEGRAPVLNFASSPAQAAAIPAVAAAAPSSEYLPANVV 240

  Fly   291 AYTGEEVQTTLSAPANQYLPP 311
            |  |::           ||||
  Fly   241 A--GQD-----------YLPP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 26/106 (25%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.