DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlC and TwdlN

DIOPT Version :9

Sequence 1:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:80/211 - (37%) Gaps:50/211 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SGVQHASGYNNGPQETKVHKHIYVHVP-PKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPA 173
            :|:.....||......::.|..:.:.. .:||:|..|:: ||   .....|..::||||.|....
  Fly   128 AGLSAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALE-RV---ASSVNKGLRVVFIKGPENRG 188

  Fly   174 IRQPVVPPPPQ-NEEKTLIYVLHKKPE-----QEQDIVIPTPPPTKPSKPEVYFIKYKTKKDEAP 232
            :....:....| .:::|.||||:|:.:     |:.:.:    .....:||||:|:||:|.:|.| 
  Fly   189 LENAALALAKQAAQQETAIYVLNKQADIGDLAQKLNAI----RSNSNNKPEVHFVKYRTPEDAA- 248

  Fly   233 VYGPPPAEMEPRQATAEDFAPLAEVADVLPPTTLAPAPEPEVEQPAIPSAVYGPPTAA---AYTG 294
                     ..::|....:..|.                      ....|:.|....|   |..|
  Fly   249 ---------NAQRAIQSQYDQLG----------------------GSSQAINGGVANALNFASAG 282

  Fly   295 EEVQTTLSAPANQYLP 310
            ...|.|...|.|.|||
  Fly   283 PVRQATAQIPENSYLP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 28/108 (26%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.