DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlC and TwdlV

DIOPT Version :9

Sequence 1:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_649446.1 Gene:TwdlV / 40537 FlyBaseID:FBgn0037227 Length:251 Species:Drosophila melanogaster


Alignment Length:323 Identity:82/323 - (25%)
Similarity:125/323 - (38%) Gaps:88/323 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VSSLFVVCVASL-VATTLGRPEPPSPYSYHGLPQQQSQRAL---PLNAHPVPPQ-IYQPLPQEQS 62
            :|...|:|:.|: :|...|....|.|..:.|:.......:.   .:...||.|| :||       
  Fly     1 MSGFIVLCLCSVALAAPQGYNYNPGPSGFGGISTTTGGGSFFQGAVQVAPVQPQAVYQ------- 58

  Fly    63 FANFAPPQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRLSGVQHASGYNNGPQETKV 127
                .|..||:     |                           |:...||.        |:..|
  Fly    59 ----QPAAQTH-----H---------------------------HQQQQVQQ--------QQAIV 79

  Fly   128 HKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQNEEKTLIY 192
            .|..::|..|   ||.:..:.| |...|..:::|.:||||:|.... |:.:...|..|||||:||
  Fly    80 SKRFFIHSAP---EEAEDYKER-HITVGVPKRNYNVVFIKSPQRNN-RKTIKISPAANEEKTVIY 139

  Fly   193 VLHKKPEQEQDIVIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAEME----PRQATAEDFAP 253
            ||.||.|.:.:..: ....:..|||||:||||||.::.|.......|:.:    ..|.|.|..||
  Fly   140 VLSKKGESDLNAEV-VEQASSTSKPEVFFIKYKTNEEAAHAQQQIQAQYDALGGSSQLTDEGVAP 203

  Fly   254 LAEVADVLPPTTLAPAPEPEVEQPAIPSA-----VYGPPTAAAYTGEEVQTTLSAPANQYLPP 311
            :..|...|      ...:..::..::..|     :....||.::||           |.||||
  Fly   204 VTSVIGAL------GGSDGHIDGGSVVGATGAGQIVSTGTAGSHTG-----------NAYLPP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 39/101 (39%)
TwdlVNP_649446.1 DM5 78..173 CDD:214776 39/100 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.