DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlC and TwdlE

DIOPT Version :9

Sequence 1:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:285 Identity:105/285 - (36%)
Similarity:129/285 - (45%) Gaps:91/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSLFVVCVASLVATTLGRPEPPSPYSYHGLPQQQSQRALPLNAHPVPPQIYQPLPQEQSFANFAP 68
            ||..:|.:.:|.|....|||||.. ||...|....|.:.|...:..      |.||      :.|
  Fly     3 SSCVLVVLMALAALVAARPEPPRD-SYSAPPSSSYQPSGPSGGYGA------PAPQ------YGP 54

  Fly    69 PQQTYLPPQMHLDAIEQVAPTAAAAEPLNAYDDSYNMAHRLSGVQHASGYNNGPQETKVHKHIYV 133
            |||               ||.                                     :|||:||
  Fly    55 PQQ---------------APV-------------------------------------IHKHVYV 67

  Fly   134 HVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQNEEKTLIYVLHKKP 198
            ||||.:.|.:   ..|......|.|||||||||||||.|....||:|..||||||||:|||.|||
  Fly    68 HVPPPEPEYQ---APRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQNEEKTLVYVLVKKP 129

  Fly   199 EQEQDIVIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAEMEPRQATAEDFAPLAEVADVLPP 263
            |::.:|:||||.||:|||||||||:|||:|:|.   ||.|..:.|         |..|..     
  Fly   130 EEQPEIIIPTPAPTQPSKPEVYFIRYKTQKEET---GPYPNSVAP---------PAPEYG----- 177

  Fly   264 TTLAPAPEPEVEQPAIPSAVYGPPT 288
               |||..|   .|:.||:.||.|:
  Fly   178 ---APAAPP---APSAPSSSYGAPS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 62/101 (61%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 63/138 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469631
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AX5Q
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.