DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlC and TwdlR

DIOPT Version :9

Sequence 1:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_733161.2 Gene:TwdlR / 318586 FlyBaseID:FBgn0051081 Length:325 Species:Drosophila melanogaster


Alignment Length:242 Identity:65/242 - (26%)
Similarity:106/242 - (43%) Gaps:48/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PLNAY-------DDSYNMAHRLSGVQHASGYNNGPQETKVHKHIYVHVPPKD-FEEEDAIQTRVH 151
            |:|:|       |:.|          |:...|:..:....|||.|....|.| .||.|..:|:: 
  Fly    39 PVNSYGNEAVLGDERY----------HSQPGNHYQENADFHKHFYAFEAPYDSVEEVDLAETKL- 92

  Fly   152 HQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQ-NEEKTLIYVLHKKPE-QEQDIVIPTPPPTKP 214
              ....||:.::||||||...|:...:.....| :|:||.||||:|:.: .|....:........
  Fly    93 --SSLAQKNLQVVFIKAPENKAVVGALNALAKQTSEDKTAIYVLNKQTDVNELASQLSALKAHHK 155

  Fly   215 SKPEVYFIKYKTKKDEAPV-------YGPPPAEMEPRQATAEDFAPLAEVADVLPPTTLAPAPEP 272
            .||:|:|:||||:::.|..       ||...:..:|.:|::..:               .|..:|
  Fly   156 HKPQVHFVKYKTEEEAAQAQQYIQAQYGGGSSIPQPGKASSLGY---------------YPEQQP 205

  Fly   273 EVEQPAIPSAVYGPPTAAAYTGEEVQTTLSAPANQYLPPATAPAALA 319
            :.||.| ||..| |.....|.....|:... |.:.||||..:.::::
  Fly   206 QYEQDA-PSEEY-PAGQVGYLPSPQQSAYQ-PQSGYLPPLPSYSSIS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 36/104 (35%)
TwdlRNP_733161.2 DUF243 69..165 CDD:281144 33/98 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.