DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlC and TwdlZ

DIOPT Version :9

Sequence 1:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_728018.2 Gene:TwdlZ / 318092 FlyBaseID:FBgn0052569 Length:210 Species:Drosophila melanogaster


Alignment Length:201 Identity:55/201 - (27%)
Similarity:86/201 - (42%) Gaps:33/201 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NGPQETKVHKHIYVHVPPKDFEEEDAIQTRVHHQQ-GPKQKHYKIVFIKAPSAPAIRQPVVPPPP 183
            |...|..:.|..|...|.:|.|:   ::.|..|.. |..:::|:::||:||:..:..........
  Fly    28 NPAMEPIITKQFYSISPAEDPED---LEPRTKHLVIGQPRRNYRVIFIRAPTGNSEHVKYTAELA 89

  Fly   184 QNEEKTLIYVLHKKPEQEQ--DIVIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAEMEPR-- 244
            ..||:|:||||.:|.::.:  ||:.|........||:|:|||||| .|||..     |:.|.:  
  Fly    90 PQEERTVIYVLTRKQQELEAADIMAPQQKSQVEQKPDVFFIKYKT-NDEAAA-----AQREIQTQ 148

  Fly   245 --------QATAEDFAPLAEVADVLPPTTLAPAPEPEVEQPAIPSAVYGPPTAAAYTGEEVQTTL 301
                    :..|...||:..|...|.......||.|...|.  |...|..|.         ::|:
  Fly   149 YDQLGGNTEIAAPYVAPIKSVIGALSSPQYPAAPYPVQRQS--PGYHYDRPD---------RSTI 202

  Fly   302 SAPANQ 307
            .||..:
  Fly   203 LAPVER 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 32/104 (31%)
TwdlZNP_728018.2 DUF243 36..132 CDD:281144 29/98 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.