DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31075 and ALDH5A1

DIOPT Version :9

Sequence 1:NP_001247324.1 Gene:CG31075 / 43244 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_733936.1 Gene:ALDH5A1 / 7915 HGNCID:408 Length:548 Species:Homo sapiens


Alignment Length:490 Identity:183/490 - (37%)
Similarity:273/490 - (55%) Gaps:33/490 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNL 101
            |:...::.:.:  ||...:||:...:..|::....:...||:||.:||.|   ||::|..:|::|
Human    64 FVGGRWLPAAA--TFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCR---WREVSAKERSSL 123

  Fly   102 MNKLCALMDRDKAFLASLETQDNGKPYAEALFDVTYSILTLQYYAGWTDKFFGDTI--PAGGFVS 164
            :.|...||.::|..||.:.|.::|||..||..::.||...|::::....:.:||.|  ||....:
Human   124 LRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRA 188

  Fly   165 MTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTIIMKPAEQTPLTALHMA------------ 217
            :..|:|:||...|.|||:|..|:..|.|.|||.|||:::||||.||.:||.:|            
Human   189 LVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAEVNQGFLLDLDP 253

  Fly   218 -ALAKEAGFPAGVINVVNGFGPTA---GAAISAHPDIAKVAFTGSVEIGRIVMQAAATSNLKRVS 278
             .||.:||.|:||.||:......|   |.||...|.::|::||||...|:|::..||.| :||||
Human   254 LLLASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANS-VKRVS 317

  Fly   279 LELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFV-AKAAAKAKARK 342
            :||||.:|.:|||.|::|.||.....:.|.|.||:|...::..|...|:|.|| |.|.|..|..:
Human   318 MELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLR 382

  Fly   343 VGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKR--IGNVGFFVEPTVFSDVKDDM 405
            |||.||:...|||.|::..:.||...:.....:||.:..||||  :|. .|| |||:..:|..||
Human   383 VGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGK-NFF-EPTLLCNVTQDM 445

  Fly   406 RIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDA 470
            ....||.|||:..:.||.:.||.|..||....|||....:.|..:..:.|..::.|.|.:|  :.
Human   446 LCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVN--EG 508

  Fly   471 VLPST--PFGGYKHSGIGRELGKDGLDNYLETKTI 503
            ::.|.  ||||.|.||:|||..|.|:|.|||.|.:
Human   509 LISSVECPFGGVKQSGLGREGSKYGIDEYLELKYV 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 183/490 (37%)
ALDH5A1NP_733936.1 SSADH 78..541 CDD:188167 179/470 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.