powered by:
Protein Alignment CG31075 and MESK4
DIOPT Version :9
Sequence 1: | NP_001247324.1 |
Gene: | CG31075 / 43244 |
FlyBaseID: | FBgn0051075 |
Length: | 508 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262650.1 |
Gene: | MESK4 / 64872 |
FlyBaseID: | FBgn0043069 |
Length: | 280 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 19/70 - (27%) |
Similarity: | 30/70 - (42%) |
Gaps: | 18/70 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 234 NGFGPTAGAAISAHPDIAKVAFTGSV--EIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDADID 296
|.:..:...:||:.|. ..|:|:.|: :.||| :.|..|||.:...|..|
Fly 58 NPYSFSGNISISSCPS-EDVSFSESILEDNGRI---SLAYENLKTIPRRLADK------------ 106
Fly 297 FAVET 301
||.:|
Fly 107 FAAQT 111
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1012 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.