DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31075 and CG31076

DIOPT Version :9

Sequence 1:NP_001247324.1 Gene:CG31075 / 43244 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster


Alignment Length:94 Identity:18/94 - (19%)
Similarity:36/94 - (38%) Gaps:29/94 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PATSKEIVQVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLM-NKLCALMDRDKAFLASL 119
            |....|::.:::.:.:|:...::..:|.|..         ||..:|. |.:|.         ..|
  Fly    76 PLPQLEVLMLNKNEFSDLPTTMRLIRKFFPN---------LQYLSLHGNPICP---------DGL 122

  Fly   120 ETQDNGKPYAEALFDVTYSILTLQYYAGW 148
            |.|    |::      ||.....:||:.:
  Fly   123 ELQ----PFS------TYLRYDYEYYSNY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 18/94 (19%)
CG31076NP_733184.2 LRR_8 11..65 CDD:290566
leucine-rich repeat 11..32 CDD:275378
leucine-rich repeat 33..54 CDD:275378
leucine-rich repeat 55..79 CDD:275378 1/2 (50%)
leucine-rich repeat 80..106 CDD:275378 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.