DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5521 and zmp:0000001168

DIOPT Version :9

Sequence 1:NP_001163748.1 Gene:CG5521 / 43242 FlyBaseID:FBgn0039466 Length:1964 Species:Drosophila melanogaster
Sequence 2:XP_009301927.1 Gene:zmp:0000001168 / 555294 ZFINID:ZDB-GENE-140106-128 Length:1274 Species:Danio rerio


Alignment Length:336 Identity:79/336 - (23%)
Similarity:127/336 - (37%) Gaps:60/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1607 LLQRSEKLMRELRNVDLQKCRETHKMAVIYVAAGQEDKGSILRNTSGSSTYEMFVSAL------- 1664
            |...|.|:...|..:|.|......|:.|:|..|||..:..:..|.|....:|.|:..|       
Zfish   461 LASTSPKVRDTLLKLDEQGLNFQRKVGVMYCRAGQSTEEDMYNNESAGPVFEEFLDLLGDRVRLK 525

  Fly  1665 GWE-----IDLETHNGFLGGLPRQGCGATAPYYATPFLEVVYHVATRMP-SDSSEAMLLKTRHLG 1723
            |||     :|.:|          ...|..:.|......|:::||:|.:| :.:::..||:.||:|
Zfish   526 GWEKYRAQLDTKT----------DSTGTHSLYTRYQDYEIMFHVSTMLPYTANNKQQLLRKRHIG 580

  Fly  1724 NDEVHIVWSEHNR-DYRRDILPTEFCDVLIVVYP----LRNGLFRVTVNRKPEVPWFGPLANESV 1783
            ||.:.||:.|... .:....:.:.|..|.|:|..    ..|..:||.|.|..::|.||||..:..
Zfish   581 NDIITIVFQEPGALPFTPKAIRSHFQHVFIIVRVHEPCTENTYYRVAVTRSKDIPLFGPLFPKGA 645

  Fly  1784 --VSGACLATLIRATAINASRTKRAALPLYQQFYEERNRSLDSVSSRYKESTTFEDFASRIYNPM 1846
              ...|.....:.|.||||......:..........|...|..::..|..:|..:....     .
Zfish   646 RFPRSAAFRDFLLAKAINAENAAEKSEKFRSMATRTRQEYLKDLAENYVTTTPIDSSTK-----F 705

  Fly  1847 PLSTLGTLRE---SNASSSAAPLASALLDHNRASVKGWVQASIDSGP---------IMGIAPSAS 1899
            ||.:||..|:   ..|..:....|.||:         |....:..|.         ::|:    |
Zfish   706 PLLSLGGKRKDKLKGAKGAELHSAGALV---------WAVTVVQGGENSVSVSLSCLLGV----S 757

  Fly  1900 AGSTAAMEAAT 1910
            |.....:|.:|
Zfish   758 AELVVLIERST 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5521NP_001163748.1 Rap_GAP 1648..1820 CDD:280332 48/191 (25%)
zmp:0000001168XP_009301927.1 Rap_GAP 502..682 CDD:307998 47/189 (25%)
PDZ_signaling <841..909 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.