DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5521 and Rap1gap2

DIOPT Version :9

Sequence 1:NP_001163748.1 Gene:CG5521 / 43242 FlyBaseID:FBgn0039466 Length:1964 Species:Drosophila melanogaster
Sequence 2:XP_006533687.1 Gene:Rap1gap2 / 380711 MGIID:3028623 Length:790 Species:Mus musculus


Alignment Length:398 Identity:93/398 - (23%)
Similarity:152/398 - (38%) Gaps:76/398 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1613 KLMRELRNVDLQKCRETHKMAVIYVAAGQEDKGSILRNTSGSSTYEMFVSALGWEIDLETHNGFL 1677
            |..:.:.:.|......|.|..|||..|.|..:..:..|...|..::.|:..||..|.|:...||.
Mouse   302 KASQMIVSYDEHDVNNTFKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGDTITLQDFKGFR 366

  Fly  1678 GGL--PRQGCGATAPYYATPFLEVVYHVATRMP-SDSSEAMLLKTRHLGNDEVHIVWSEHNRDYR 1739
            |||  .....|..:.|......|:::||:|::| :|.....|.:.||:|||.|.|::.|.|..:.
Mouse   367 GGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDTQQLQRKRHIGNDIVAIIFQEENTPFV 431

  Fly  1740 RDILPTEFCDVLIVVYPLRNGL----FRVTVNRKPEVPWFG-PLANESVV-SGACLATLIRATAI 1798
            .|::.:.|....|||.....|.    ::|:|..:.:||.|| ||.:..|. .||.....:.....
Mouse   432 PDMIASNFLHAYIVVQADNPGTETPSYKVSVTAREDVPAFGPPLPSPPVFQKGAEFREFLLTKLT 496

  Fly  1799 NA--------------SRTKRAALPLYQQFYEERNRSLDSVSSRYKESTTFED-----------F 1838
            ||              .||:.|   |....::|.:.....:.....|...||:           .
Mouse   497 NAENACCKSDKFAKLEDRTRAA---LLDNLHDELHTHTQVMLGMGPEEDKFENGGHGGFLESFKR 558

  Fly  1839 ASRIYNPMPLSTLGTLRESNASSSAAPLASALLDHNRASVKGWVQASIDSGPI------------ 1891
            |.|:.:....:.:|:.|:.:..:....|:..:: ||...    |..:..|.|:            
Mouse   559 AIRVRSHSMETMVGSQRKLHGGNLPGSLSGGIV-HNSME----VTKTTFSPPVAAATAKNQSRSP 618

  Fly  1892 ----MGIAPSASAGSTAAMEAATGMSSAS--PRGPRKLGAPFKSVTKKHSLQHIAVGGGAGAGGD 1950
                .|:.|...:||....::.|...|||  |:.|          ...||.|.|.      :...
Mouse   619 IKRRSGLFPRLHSGSEGQGDSRTRCDSASSTPKTP----------DGGHSSQEIK------SETS 667

  Fly  1951 TPPESPTL 1958
            :.|.||.:
Mouse   668 SNPSSPEI 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5521NP_001163748.1 Rap_GAP 1648..1820 CDD:280332 54/194 (28%)
Rap1gap2XP_006533687.1 Rap_GAP 337..516 CDD:366939 50/178 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3686
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.