DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5521 and Sipa1l2

DIOPT Version :9

Sequence 1:NP_001163748.1 Gene:CG5521 / 43242 FlyBaseID:FBgn0039466 Length:1964 Species:Drosophila melanogaster
Sequence 2:XP_038953828.1 Gene:Sipa1l2 / 361442 RGDID:1306269 Length:1741 Species:Rattus norvegicus


Alignment Length:320 Identity:74/320 - (23%)
Similarity:123/320 - (38%) Gaps:45/320 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1611 SEKLMRELRNVDLQKCRETHKMAVIYVAAGQEDKGSILRNTSGSSTYEMFVSALGWEIDLETHNG 1675
            |.|:..:|..:|.|.....||:.::|..|||..:..:..|.:....:|.|:..||..:.|:..:.
  Rat   589 SPKVPEQLLKLDEQGLSFQHKIGILYCKAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSK 653

  Fly  1676 FLGGLPRQ--GCGATAPYYATPFLEVVYHVATRMP-SDSSEAMLLKTRHLGNDEVHIVWSEHNRD 1737
            :...|..:  ..|..:.|......|:::||:|.:| ..::...||:.||:|||.|.|::.|..  
  Rat   654 YRAQLDNKTDSTGTHSLYTTYKDFELMFHVSTLLPYMPNNRQQLLRKRHIGNDIVTIIFQEPG-- 716

  Fly  1738 YRRDILP-------TEFCDVLIVVYP----LRNGLFRVTVNRKPEVPWFGPLANESVV--SGACL 1789
                .||       :.|..|.::|..    ..|..:.|.|:|..:||.|||...:.|.  ..|..
  Rat   717 ----ALPFTPKNIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVF 777

  Fly  1790 ATLIRATAINASRTKRAALPLYQQFYEERNRSLDSVSSRYKESTTFEDFASRIYNPMPLSTLGTL 1854
            ...:.|..|||......:..........|...|..::..:..:||.:..|.     ....|||..
  Rat   778 RDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAENFVTTTTVDTSAK-----FSFITLGAK 837

  Fly  1855 RESNASSSAAPLASALLDHNRASVKGWVQASIDSGPIMGIAPSASAGSTAAMEAATGMSS 1914
            ::....    |...|.|              ...|.||....:...|.:|.:|...|:|:
  Rat   838 KKERVK----PRKDAHL--------------FSIGAIMWHVVARDFGQSADIECLLGISN 879

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5521NP_001163748.1 Rap_GAP 1648..1820 CDD:280332 45/187 (24%)
Sipa1l2XP_038953828.1 Rap_GAP 626..806 CDD:396632 44/185 (24%)
PDZ_signaling 951..1021 CDD:238492
SPAR_C 1423..1685 CDD:403176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3686
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.