DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5521 and Rap1gap

DIOPT Version :9

Sequence 1:NP_001163748.1 Gene:CG5521 / 43242 FlyBaseID:FBgn0039466 Length:1964 Species:Drosophila melanogaster
Sequence 2:NP_001094183.1 Gene:Rap1gap / 313644 RGDID:1309908 Length:753 Species:Rattus norvegicus


Alignment Length:436 Identity:100/436 - (22%)
Similarity:156/436 - (35%) Gaps:121/436 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1613 KLMRELRNVDLQKCRETHKMAVIYVAAGQEDKGSILRNTSGSSTYEMFVSALGWEIDLETHNGFL 1677
            |..|.:...|........|..|||...||..:..:......|..:..|:..||.::.|:...||.
  Rat   240 KASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFR 304

  Fly  1678 GGL--PRQGCGATAPYYATPFLEVVYHVATRMPSDSSEA-MLLKTRHLGNDEVHIVWSEHNRDYR 1739
            |||  .....|..:.|......|:::||:|::|....:| .|.:.||:|||.|.:|:.:.|..:.
  Rat   305 GGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDENTPFV 369

  Fly  1740 RDILPTEFCDVLIVVYPLRNG----LFRVTVNRKPEVPWFGPLANESVV--SGACLATLIRATAI 1798
            .|::.:.|....:||.....|    |::|:|..:.:||:|||...:..|  .|......:....|
  Rat   370 PDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPEFQEFLLTKLI 434

  Fly  1799 NA--------------SRTKRAAL-PLYQQ--------------------------FYE------ 1816
            ||              .||:.|.| .||::                          |:|      
  Rat   435 NAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDDDKMENGSGGGGFFESFKRVI 499

  Fly  1817 -ERNRSLDSVSSRYKESTTFEDFASRIYNPMPLSTLGTLRESNASSSAAPLASALLDHNRASVKG 1880
             .|::|:|::....|:.           |.:..|..|:...:|...:.|...|.|:....||..|
  Rat   500 RSRSQSMDAMGLSNKKP-----------NTVSTSHSGSFTPNNPDLAKAAGISLLIPGKSASRFG 553

  Fly  1881 WVQASIDSGPIMGIAPSASAGSTAAMEAATGMSSASPRGPRKLGAPFKSVTKKHSLQHIAVG--- 1942
                  ..|..:||         .|:|.:..:...||  .||...||.|  ::.|    |:|   
  Rat   554 ------RRGSALGI---------GAVEESLIVPGKSP--TRKKSGPFGS--RRSS----AIGIEN 595

  Fly  1943 --------GGAGAGGDTP-------------------PESPTLPQR 1961
                    ....||..||                   ||.||...|
  Rat   596 IQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNR 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5521NP_001163748.1 Rap_GAP 1648..1820 CDD:280332 54/228 (24%)
Rap1gapNP_001094183.1 GoLoco 61..81 CDD:214645
Rap_GAP 275..454 CDD:280332 46/178 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3686
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.