DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5521 and Rap1gap2

DIOPT Version :9

Sequence 1:NP_001163748.1 Gene:CG5521 / 43242 FlyBaseID:FBgn0039466 Length:1964 Species:Drosophila melanogaster
Sequence 2:XP_017452778.1 Gene:Rap1gap2 / 303298 RGDID:1304590 Length:808 Species:Rattus norvegicus


Alignment Length:396 Identity:93/396 - (23%)
Similarity:153/396 - (38%) Gaps:72/396 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1613 KLMRELRNVDLQKCRETHKMAVIYVAAGQEDKGSILRNTSGSSTYEMFVSALGWEIDLETHNGFL 1677
            |..:.:.:.|......|.|..|||..|.|..:..:..|...|..::.|:..||..|.|:...||.
  Rat   320 KASQMIVSYDEHDVNNTFKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGDTITLQDFKGFR 384

  Fly  1678 GGL--PRQGCGATAPYYATPFLEVVYHVATRMP-SDSSEAMLLKTRHLGNDEVHIVWSEHNRDYR 1739
            |||  .....|..:.|......|:::||:|::| :|.....|.:.||:|||.|.|::.|.|..:.
  Rat   385 GGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDTQQLQRKRHIGNDIVAIIFQEENTPFV 449

  Fly  1740 RDILPTEFCDVLIVVYPLRNGL----FRVTVNRKPEVPWFG-PLANESVV-SGACLATLIRATAI 1798
            .|::.:.|....|||.....|.    ::|:|..:.:||.|| ||.:..|. .|......:.....
  Rat   450 PDMIASNFLHAYIVVQAESTGTETPSYKVSVTAREDVPAFGPPLPSPPVFQKGTEFREFLLTKLT 514

  Fly  1799 NA--------------SRTKRAALPLYQQFYEERNRSLDSVSSRYKESTTFED-----------F 1838
            ||              .||:.|   |....::|.:.....:.....|...||:           .
  Rat   515 NAENACCKSDKFAKLEDRTRAA---LLDNLHDELHTHTQVMLGMGPEEDKFENGGHGGFLESFKR 576

  Fly  1839 ASRIYNPMPLSTLGTLRESNASSSAAPLASALLDHN--------------RASVKGWVQASIDSG 1889
            |.|:.:....:.:|:.|:.:..:....|:..:: ||              .|:||...::.|...
  Rat   577 AIRVRSHSMETMVGSQRKLHGGNIPGSLSGGIV-HNSMEVTKTTFSPPVAAATVKNQSRSPIKRR 640

  Fly  1890 PIMGIAPSASAGSTAAMEAATGMSSAS--PRGPRKLGAPFKSVTKKHSLQHIAVGGGAGAGGDTP 1952
              .|:.|...:||....::.|...|||  |:.|          ...||.|.|.      :...:.
  Rat   641 --SGLFPRLHSGSEGQGDSRTRCDSASSTPKTP----------DGGHSSQEIK------SETSSN 687

  Fly  1953 PESPTL 1958
            |.||.:
  Rat   688 PSSPEI 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5521NP_001163748.1 Rap_GAP 1648..1820 CDD:280332 53/194 (27%)
Rap1gap2XP_017452778.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.