DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5521 and SIPA1L3

DIOPT Version :9

Sequence 1:NP_001163748.1 Gene:CG5521 / 43242 FlyBaseID:FBgn0039466 Length:1964 Species:Drosophila melanogaster
Sequence 2:NP_055888.1 Gene:SIPA1L3 / 23094 HGNCID:23801 Length:1781 Species:Homo sapiens


Alignment Length:553 Identity:119/553 - (21%)
Similarity:191/553 - (34%) Gaps:164/553 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1405 VRVLMRDLNGKACWDASILYSEPRNAEEPPKTTPKIQHSQPLDSMATSMVTHTPSPRHTLRHRPA 1469
            |:.::.|||..|....|:  |:.||.     ||     .....|.|::|.:.|.|..|:|    .
Human   345 VQSMLFDLNEAAANRVSV--SQRRNT-----TT-----GASAASAASAMASLTASRAHSL----G 393

  Fly  1470 GVLP---------LAKDMAPDL--DQLDDMLAYIGH----TSPECVAPTVSQLNAPTASPLSGN- 1518
            |:.|         ..:::..||  |..:|:|....|    ...|| ...||...|...||.||. 
Human   394 GLDPAFTSTEDLNCKENLEQDLGDDNSNDLLLSCPHFRNEIGGEC-ERNVSFSRASVGSPSSGEG 457

  Fly  1519 ----------QEAQAISVI----------------------LNQRLLEQEFV------------- 1538
                      :...:|||:                      |..|..:..||             
Human   458 HLAEPALSAYRTNASISVLEVPKEQQRTQSRPRQYSIEHVDLGARYYQDYFVGKEHANYFGVDEK 522

  Fly  1539 --------------THSTQAPSPALRHASSNSSLQQPDQRSLHSTTASF--DSLPTRTE------ 1581
                          .|....|....|.....        |.|.:...|.  |:.||.|:      
Human   523 LGPVAVSIKREKLEDHKEHGPQYQYRIIFRT--------RELITLRGSILEDATPTATKHGTGRG 579

  Fly  1582 MPFQ-YCRLLFSHLGLAGWERRSRTHLLQ---RSEKLMRELRNVDLQKCRETHKMAVIYVAAGQE 1642
            :|.: ....:...|.:         |.|:   .:.|:..:|..:|.|.....||:.::|..|||.
Human   580 LPLKDALEYVIPELNI---------HCLRLALNTPKVTEQLLKLDEQGLCRKHKVGILYCKAGQS 635

  Fly  1643 DKGSILRNTSGSSTYEMFVSALGWEIDLETHNGFLGGL--PRQGCGATAPYYATPFLEVVYHVAT 1705
            .:..:..|......:|.|:|.:|.::.|:....:...|  .....|..:.|......|:::||:|
Human   636 SEEEMYNNEEAGPAFEEFLSLIGEKVCLKGFTKYAAQLDVKTDSTGTHSLYTMYQDYEIMFHVST 700

  Fly  1706 RMP-SDSSEAMLLKTRHLGNDEVHIVWSEHNRDYRRDILP-------TEFCDVLIVV---YPLR- 1758
            .:| :.::...||:.||:|||.|.|::.|..      .||       :.|..|.|:|   .|.. 
Human   701 LLPYTPNNRQQLLRKRHIGNDIVTIIFQEPG------ALPFTPKNIRSHFQHVFIIVRVHNPCTD 759

  Fly  1759 NGLFRVTVNRKPEVPWFGP-------LANESVVSGACLATLIRA--TAINASRTKRAALPLYQQF 1814
            |..:.:.|.|..:.|.|||       .....|.....||.:|.|  .|..:.:....|....|::
Human   760 NVCYSMAVTRSKDAPPFGPPIPSGTTFRKSDVFRDFLLAKVINAENAAHKSDKFHTMATRTRQEY 824

  Fly  1815 YEE------RNRSLD--------SVSSRYKEST 1833
            .::      .|..:|        |::|:.||.|
Human   825 LKDLAENCVSNTPIDSTGKFNLISLTSKKKEKT 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5521NP_001163748.1 Rap_GAP 1648..1820 CDD:280332 46/200 (23%)
SIPA1L3NP_055888.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..332
Rap_GAP 641..821 CDD:280332 45/185 (24%)
PDZ_signaling 966..1036 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1046..1112
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1124..1221
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1236..1565
SPAR_C 1477..1726 CDD:288714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1583..1636
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1685..1712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3686
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.