DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and tspan13a

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001002334.1 Gene:tspan13a / 798836 ZFINID:ZDB-GENE-040718-19 Length:203 Species:Danio rerio


Alignment Length:211 Identity:85/211 - (40%)
Similarity:127/211 - (60%) Gaps:19/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CGGFTCSKNALIALNILYVMIGFLLIGVGVYARAASIVTNLPIVGGILACGVILICISMLGLAGA 66
            ||||.|||..|..||::||::..|||||..:.:...:|::..::|.::|.|:.|..::::||.||
Zfish     3 CGGFVCSKTCLCILNLIYVLVSLLLIGVAAWGKWFGLVSSFSVMGAVIAVGLFLFIVAIIGLCGA 67

  Fly    67 VKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQGWMTVPTDLRKQVQDSLKCCGF 131
            ||||||:|||||.|||::|::|||::.:|||:|.|||....|.|| .....::..::.||.||.|
Zfish    68 VKHHQVLLFFYMFILFLVFIVQFSVSCACLAINKEQQNLLLEIGW-NKSESMQSDLERSLNCCDF 131

  Fly   132 NATAPSTTSVVPPSNEPSCELINQQCCAHSSEPDCRCEPCGPLLEDKIDYAFKLCGGLGIFFSFT 196
                      :......|||   ..|....:     |:||..:::...|.|.:..||:.:|||||
Zfish   132 ----------LQVDYSGSCE---ATCFKEKT-----CKPCSVIIQAYADDALQFVGGISLFFSFT 178

  Fly   197 EVLAVFLARRYRNQHD 212
            |:|..:||.|||||.|
Zfish   179 EILGFWLAYRYRNQKD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 73/196 (37%)
tetraspanin_LEL <121..177 CDD:243179 12/55 (22%)
tspan13aNP_001002334.1 Tetraspannin 8..192 CDD:278750 78/202 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4082
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3855
OMA 1 1.010 - - QHG52462
OrthoDB 1 1.010 - - D1203231at2759
OrthoFinder 1 1.000 - - FOG0003591
OrthoInspector 1 1.000 - - otm25403
orthoMCL 1 0.900 - - OOG6_105658
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.