DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp42Eb

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster


Alignment Length:195 Identity:46/195 - (23%)
Similarity:70/195 - (35%) Gaps:55/195 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KNALIALNILYVMIGFLLIGVGVYARAASIVTNLPIVGG----------ILACGVILICISMLGL 63
            |..|..||:::|..|.|||.||  :...|.:.|.....|          |:..|.:...::..|.
  Fly     9 KYLLYLLNLVFVAGGILLIVVG--SIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFVVAFFGC 71

  Fly    64 AGAVKHHQVMLFFYMIILFMLFLIQFS------------IASSCLAVNSEQQQQFAEQGWMTVPT 116
            .|.::.:......|.|.:.:||.:|.:            ::|...||:....:..|.||:   |.
  Fly    72 CGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNAAQGY---PM 133

  Fly   117 DLRKQVQDSLKCCGFNATAPSTTSVVPPSNEPSCELINQQCCA------------HSSEPDCRCE 169
            |   .:|.:..|||  .|.......||.|           ||.            :|..|.||.|
  Fly   134 D---ALQLAFSCCG--NTGYQQYETVPSS-----------CCGYKDRTKVCEAEIYSQRPGCRQE 182

  Fly   170  169
              Fly   183  182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 46/195 (24%)
tetraspanin_LEL <121..177 CDD:243179 15/61 (25%)
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 46/195 (24%)
tetraspanin_LEL 104..191 CDD:239401 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.