DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and tspan31

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001017068.1 Gene:tspan31 / 549822 XenbaseID:XB-GENE-942512 Length:215 Species:Xenopus tropicalis


Alignment Length:213 Identity:95/213 - (44%)
Similarity:140/213 - (65%) Gaps:7/213 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCGGFTCSKNALIALNILYVMIGFLLIGVGVYARAASIVTNLPIVGGILACGVILICISMLGLAG 65
            :|||||||||||.|||::|:::|.|||||..:.:...||:::.|:||::|.||.|:.|:::||.|
 Frog     2 VCGGFTCSKNALCALNVVYMLVGLLLIGVAAWGKGFGIVSSIHIIGGVIAIGVFLLLIAIIGLIG 66

  Fly    66 AVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQGWMTVPTDLRKQVQDSLKCCG 130
            ||.|||||||.||::|.::|:.||.::.||||:|..||:.|....|..:..|.|..::.:|:|||
 Frog    67 AVSHHQVMLFIYMVVLILVFIFQFIVSCSCLAMNRSQQEYFLNTTWTRMSNDTRLNLEKTLECCG 131

  Fly   131 FNATAPSTTSVVPPSNEPSCELINQQCCAHSSEPDCRCEPCGPLLEDKIDYAFKLCGGLGIFFSF 195
            |..|..:....  ..:...|.  ..|.|:.:.:   :|..||..:.:..|.|.|:.||:|:||||
 Frog   132 FLNTTDAREEF--KMDVALCS--KAQVCSQNPQ---KCLSCGDKMLNHADEALKILGGVGLFFSF 189

  Fly   196 TEVLAVFLARRYRNQHDP 213
            ||:|.|:||.|||||.||
 Frog   190 TEILGVWLAFRYRNQKDP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 81/196 (41%)
tetraspanin_LEL <121..177 CDD:243179 12/55 (22%)
tspan31NP_001017068.1 Tetraspannin 9..201 CDD:366035 82/198 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 167 1.000 Domainoid score I3805
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3674
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203231at2759
OrthoFinder 1 1.000 - - FOG0003591
OrthoInspector 1 1.000 - - otm49463
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6361
SonicParanoid 1 1.000 - - X2941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.