DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp97E and Tsp96F

DIOPT Version :9

Sequence 1:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:266 Identity:56/266 - (21%)
Similarity:98/266 - (36%) Gaps:62/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GGFTCSKNALIALNILYVMIGFLLIGVGVYARA-----ASIVTN-------LPIVGGILACGVIL 55
            |..:|.|..::.:|||:.:||..::...|:...     .|:..|       |.:   .||.|:::
  Fly     5 GCCSCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYV---FLAIGILI 66

  Fly    56 ICISMLGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCL------------AVNSEQQQQFAE 108
            ...:..|..|..:..|.:|..:..::.::.:.|.:..:...            ||.|..|:::. 
  Fly    67 TLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYG- 130

  Fly   109 QGWMTVPTDLRKQVQDSLKCCG-----------FNATAPSTTSVVPPSNEPSCELINQQCCAHSS 162
            |..|:..|.....:|.:|||||           ||....:....:..|:......|.:.||..:.
  Fly   131 QSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNL 195

  Fly   163 EPDCRCEPC------GPL--------LEDK---IDY-----AFKLCGGLGIFFSFTEVLAVFLAR 205
            : |..||..      |||        ..||   |.|     .|.:...:.:....:...|:.|..
  Fly   196 K-DNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCC 259

  Fly   206 RYRNQH 211
            ..||||
  Fly   260 AVRNQH 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 50/253 (20%)
tetraspanin_LEL <121..177 CDD:243179 18/80 (23%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 51/256 (20%)
CD151_like_LEL 107..233 CDD:239408 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442890
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.